Lineage for d4pp2b_ (4pp2 B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (23 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (610 PDB entries)
  8. 2744876Domain d4pp2b_: 4pp2 B: [409344]
    Other proteins in same PDB: d4pp2a1, d4pp2a2, d4pp2c1, d4pp2c2
    automated match to d6shgh_
    complexed with ca, nag

Details for d4pp2b_

PDB Entry: 4pp2 (more details), 2.74 Å

PDB Description: the crystal structure of der p 1 allergen complexed with fab fragment of mab 10b9
PDB Compounds: (B:) heavy chain of Fab fragment of 10B9 antibody

SCOPe Domain Sequences for d4pp2b_:

Sequence, based on SEQRES records: (download)

>d4pp2b_ b.1.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evqlvesgpslvkpsqtlsltcsvtgdsitsgfwnwirkfpgnklefmgyitysgtsyyk
pslksrisitrdtsknqyflqlnsvtaedtatyycarrgflttvnyyamdywgqgtsvtv
ssakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlq
sdlytlsssvtvpsstwpsetvtcnvahpasstkvdkkivpr

Sequence, based on observed residues (ATOM records): (download)

>d4pp2b_ b.1.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evqlvesgpslvkpsqtlsltcsvtgdsitsgfwnwirkfpgnklefmgyitysgtsyyk
pslksrisitrdtsknqyflqlnsvtaedtatyycarrgflttvnyyamdywgqgtsvtv
ssakttppsvyplapsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytls
ssvtvpsstwpsetvtcnvahpasstkvdkkivpr

SCOPe Domain Coordinates for d4pp2b_:

Click to download the PDB-style file with coordinates for d4pp2b_.
(The format of our PDB-style files is described here.)

Timeline for d4pp2b_:

  • d4pp2b_ is new in SCOPe 2.08-stable