Lineage for d4otxh_ (4otx H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (23 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (610 PDB entries)
  8. 2744621Domain d4otxh_: 4otx H: [409327]
    Other proteins in same PDB: d4otxl1, d4otxl2, d4otxm1, d4otxm2
    automated match to d6shgh_
    complexed with azi, cl

Details for d4otxh_

PDB Entry: 4otx (more details), 2.1 Å

PDB Description: structure of the anti-francisella tularensis o-antigen antibody n203 fab fragment
PDB Compounds: (H:) N203 heavy chain

SCOPe Domain Sequences for d4otxh_:

Sequence, based on SEQRES records: (download)

>d4otxh_ b.1.1.1 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evqlqqsgaelarpgasvklsckasgytftsywmqwvkqrpgqglewigaiypgdgdtry
tqkfkgkatltadkssstaymqlsslasedsavyycarrwdywgqgttltvssakttaps
vyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytlsss
vtvtsstwpsqsitcnvahpasstkvdkkiepr

Sequence, based on observed residues (ATOM records): (download)

>d4otxh_ b.1.1.1 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evqlqqsgaelarpgasvklsckasgytftsywmqwvkqrpgqglewigaiypgdgdtry
tqkfkgkatltadkssstaymqlsslasedsavyycarrwdywgqgttltvssakttaps
vyplapvcsvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytlsssvtvtss
twpsqsitcnvahpasstkvdkkiepr

SCOPe Domain Coordinates for d4otxh_:

Click to download the PDB-style file with coordinates for d4otxh_.
(The format of our PDB-style files is described here.)

Timeline for d4otxh_:

  • d4otxh_ is new in SCOPe 2.08-stable