Lineage for d4okva1 (4okv A:6-214)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) Protein automated matches [190119] (24 species)
not a true protein
Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries) 
Domain d4okva1: 4okv A:6-214 [409317]
Other proteins in same PDB: d4okva2, d4okvb1, d4okvb2, d4okvc2, d4okvd1, d4okvd2
automated match to d6shgh_
Details for d4okva1
PDB Entry: 4okv (more details), 1.8 Å
PDB Description: Crystal structure of anopheline anti-platelet protein with Fab antibody
PDB Compounds: (A:) heavy chain of 8H7 mAbSCOPe Domain Sequences for d4okva1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4okva1 b.1.1.1 (A:6-214) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qpgaelvrpgasvklsckasgytftsywmnwvkqrpgqglewiglidpsdsethynqmfk
dkatltvdkssstaymqlssltsedsavyycarggtywgqgttltvsaakttppsvypla
pgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsssvtvps
stwpsetvtcnvahpasstkvdkkivprd
SCOPe Domain Coordinates for d4okva1:
Click to download the PDB-style file with coordinates for d4okva1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4okva1:
- d4okva1 is new in SCOPe 2.08-stable
View in 3D
