Lineage for d4okva1 (4okv A:6-214)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (621 PDB entries)
  8. 2744363Domain d4okva1: 4okv A:6-214 [409317]
    Other proteins in same PDB: d4okva2, d4okvb1, d4okvb2, d4okvc2, d4okvd1, d4okvd2
    automated match to d6shgh_

Details for d4okva1

PDB Entry: 4okv (more details), 1.8 Å

PDB Description: Crystal structure of anopheline anti-platelet protein with Fab antibody
PDB Compounds: (A:) heavy chain of 8H7 mAb

SCOPe Domain Sequences for d4okva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4okva1 b.1.1.1 (A:6-214) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qpgaelvrpgasvklsckasgytftsywmnwvkqrpgqglewiglidpsdsethynqmfk
dkatltvdkssstaymqlssltsedsavyycarggtywgqgttltvsaakttppsvypla
pgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsssvtvps
stwpsetvtcnvahpasstkvdkkivprd

SCOPe Domain Coordinates for d4okva1:

Click to download the PDB-style file with coordinates for d4okva1.
(The format of our PDB-style files is described here.)

Timeline for d4okva1:

  • d4okva1 is new in SCOPe 2.08-stable