Lineage for d4ogym_ (4ogy M:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742214Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)
  8. 2742520Domain d4ogym_: 4ogy M: [409312]
    Other proteins in same PDB: d4ogya_, d4ogyb_, d4ogyl1, d4ogyl2, d4ogyn1, d4ogyn2
    automated match to d6shgh_
    complexed with edo

Details for d4ogym_

PDB Entry: 4ogy (more details), 2.1 Å

PDB Description: Crystal structure of Fab DX-2930 in complex with human plasma kallikrein at 2.1 Angstrom resolution
PDB Compounds: (M:) dx-2930 heavy chain

SCOPe Domain Sequences for d4ogym_:

Sequence, based on SEQRES records: (download)

>d4ogym_ b.1.1.1 (M:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vqllesggglvqpggslrlscaasgftfshyimmwvrqapgkglewvsgiyssggitvya
dsvkgrftisrdnskntlylqmnslraedtavyycayrrigvprrdefdiwgqgtmvtvs
sastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqs
sglyslssvvtvpssslgtqtyicnvnhkpsntkvdkrvep

Sequence, based on observed residues (ATOM records): (download)

>d4ogym_ b.1.1.1 (M:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vqllesggglvqpggslrlscaasghyimmwvrqapgkglewvsgiyssggitvyadsvk
grftisrdnskntlylqmnslraedtavyycayrrigvprrdefdiwgqgtmvtvssast
kgpsvfplaptaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssvvtv
yicnvnhkpsntkvdkrvep

SCOPe Domain Coordinates for d4ogym_:

Click to download the PDB-style file with coordinates for d4ogym_.
(The format of our PDB-style files is described here.)

Timeline for d4ogym_:

  • d4ogym_ is new in SCOPe 2.08-stable