Lineage for d1qqqa_ (1qqq A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2212073Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 2212074Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. 2212075Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. 2212113Protein Thymidylate synthase [55833] (7 species)
  7. 2212128Species Escherichia coli [TaxId:562] [55834] (67 PDB entries)
  8. 2212142Domain d1qqqa_: 1qqq A: [40931]
    complexed with so4; mutant

Details for d1qqqa_

PDB Entry: 1qqq (more details), 1.5 Å

PDB Description: crystal structure analysis of ser254 mutant of escherichia coli thymidylate synthase
PDB Compounds: (A:) Thymidylate synthase

SCOPe Domain Sequences for d1qqqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qqqa_ d.117.1.1 (A:) Thymidylate synthase {Escherichia coli [TaxId: 562]}
mkqylelmqkvldegtqkndrtgtgtlsifghqmrfnlqdgfplvttkrchlrsiihell
wflqgdtniaylhennvtiwdewadengdlgpvygkqwrawptpdgrhidqittvlnqlk
ndpdsrriivsawnvgeldkmalapchaffqfyvadgklscqlyqrscdvflglpfnias
yallvhmmaqqcdlevgdfvwtggdthlysnhmdqthlqlsreprplpkliikrkpesif
dyrfedfeiegydshpgikapvai

SCOPe Domain Coordinates for d1qqqa_:

Click to download the PDB-style file with coordinates for d1qqqa_.
(The format of our PDB-style files is described here.)

Timeline for d1qqqa_: