Lineage for d1dbua_ (1dbu A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2972065Fold d.116: YbaK/ProRS associated domain [55825] (1 superfamily)
    core: alpha-beta-alpha-beta(2)-(alpha-beta)2-alpha-beta(2)-alpha-beta; 3 layers; bifurcated mixed sheet
  4. 2972066Superfamily d.116.1: YbaK/ProRS associated domain [55826] (2 families) (S)
  5. 2972067Family d.116.1.1: YbaK/ProRS associated domain [55827] (4 proteins)
    Pfam PF04073
  6. 2972082Protein Hypothetical protein HI1434 (YbaK homologue) [55828] (1 species)
  7. 2972083Species Haemophilus influenzae [TaxId:727] [55829] (2 PDB entries)
  8. 2972086Domain d1dbua_: 1dbu A: [40930]
    structural genomics
    complexed with hg

Details for d1dbua_

PDB Entry: 1dbu (more details), 1.8 Å

PDB Description: Crystal structure of cysteinyl-tRNA(Pro) deacylase protein from H. influenzae (HI1434)
PDB Compounds: (A:) cysteinyl-tRNA(Pro) deacylase

SCOPe Domain Sequences for d1dbua_:

Sequence, based on SEQRES records: (download)

>d1dbua_ d.116.1.1 (A:) Hypothetical protein HI1434 (YbaK homologue) {Haemophilus influenzae [TaxId: 727]}
tpaidllkkqkipfilhtydhdpnnqhfgdeaaeklgidpnrsfktllvaengdqkklac
fvlatanmlnlkkaaksigvkkvemadkdaaqkstgylvggisplgqkkrvktvinstal
efetiyvsggkrglsveiapqdlakvlgaeftdivde

Sequence, based on observed residues (ATOM records): (download)

>d1dbua_ d.116.1.1 (A:) Hypothetical protein HI1434 (YbaK homologue) {Haemophilus influenzae [TaxId: 727]}
tpaidllkkqkipfilhtydhdpndeaaeklgidpnrsfktllvaengdqkklacfvlat
anmlnlkkaaksigvkkvemadkdaaqkstgylvggisplgqkkrvktvinstalefeti
yvsggkrglsveiapqdlakvlgaeftdivde

SCOPe Domain Coordinates for d1dbua_:

Click to download the PDB-style file with coordinates for d1dbua_.
(The format of our PDB-style files is described here.)

Timeline for d1dbua_: