Lineage for d1dbxb_ (1dbx B:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 35317Fold d.116: Hypothetica protein HI1434 (YbaK homologue) [55825] (1 superfamily)
  4. 35318Superfamily d.116.1: Hypothetica protein HI1434 (YbaK homologue) [55826] (1 family) (S)
  5. 35319Family d.116.1.1: Hypothetica protein HI1434 (YbaK homologue) [55827] (1 protein)
  6. 35320Protein Hypothetica protein HI1434 (YbaK homologue) [55828] (1 species)
  7. 35321Species Haemophilus influenzae [TaxId:727] [55829] (2 PDB entries)
  8. 35323Domain d1dbxb_: 1dbx B: [40929]

Details for d1dbxb_

PDB Entry: 1dbx (more details), 1.8 Å

PDB Description: Crystal structure of cysteinyl-tRNA(Pro) deacylase from H. influenzae (HI1434)

SCOP Domain Sequences for d1dbxb_:

Sequence, based on SEQRES records: (download)

>d1dbxb_ d.116.1.1 (B:) Hypothetica protein HI1434 (YbaK homologue) {Haemophilus influenzae}
tpaidllkkqkipfilhtydhdpnnqhfgdeaaeklgidpnrsfktllvaengdqkklac
fvlatanmlnlkkaaksigvkkvemadkdaaqkstgylvggisplgqkkrvktvinstal
efetiyvsggkrglsveiapqdlakvlgaeftdivde

Sequence, based on observed residues (ATOM records): (download)

>d1dbxb_ d.116.1.1 (B:) Hypothetica protein HI1434 (YbaK homologue) {Haemophilus influenzae}
tpaidllkkqkipfilhtydhdpgdeaaeklgidpnrsfktllvaengdqkklacfvlat
anmlnlkkaaksigvkkvemadkdaaqkstgylvggisplgqkkrvktvinstalefeti
yvsggkrglsveiapqdlakvlgaeftdivde

SCOP Domain Coordinates for d1dbxb_:

Click to download the PDB-style file with coordinates for d1dbxb_.
(The format of our PDB-style files is described here.)

Timeline for d1dbxb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1dbxa_