Lineage for d4oawb_ (4oaw B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2759021Domain d4oawb_: 4oaw B: [409283]
    Other proteins in same PDB: d4oawa2, d4oawc2
    automated match to d6shgh_
    complexed with gol, so4

Details for d4oawb_

PDB Entry: 4oaw (more details), 2.8 Å

PDB Description: fab structure of anti-hiv gp120 v2 mab 2158
PDB Compounds: (B:) Heavy chain of Fab fragment of anti-HIV1 gp120 V2 mAb 2158

SCOPe Domain Sequences for d4oawb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4oawb_ b.1.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvqlvqsgaevkkpgssvkvsceasgvtsssytiswvrlapgqglewmgritpifditny
aqkfqgrvtltadkstgttymelsslrsddtavyycardksdvvvvtsirpayyygmdvw
gqgttvtvssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgv
htfpavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepkscdkt

SCOPe Domain Coordinates for d4oawb_:

Click to download the PDB-style file with coordinates for d4oawb_.
(The format of our PDB-style files is described here.)

Timeline for d4oawb_:

  • d4oawb_ is new in SCOPe 2.08-stable