Lineage for d4o58h_ (4o58 H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2757392Domain d4o58h_: 4o58 H: [409279]
    Other proteins in same PDB: d4o58a1, d4o58a2, d4o58b_, d4o58l2
    automated match to d6shgh_
    complexed with nag, peg, so4

Details for d4o58h_

PDB Entry: 4o58 (more details), 2.75 Å

PDB Description: crystal structure of broadly neutralizing antibody f045-092 in complex with a/victoria/3/1975 (h3n2) influenza hemagglutinin
PDB Compounds: (H:) Fab F045-092 heavy chain

SCOPe Domain Sequences for d4o58h_:

Sequence, based on SEQRES records: (download)

>d4o58h_ b.1.1.0 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvesgaevkkpgssvkvscrasgtfykyainwvrqapgqglewmggiipffgttnya
qkfqgrltitadgstntaymqldslrsedtavyycagpsiteshycldcaakdyyygldv
wgqgttvtvssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsg
vhtfpavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkrvep

Sequence, based on observed residues (ATOM records): (download)

>d4o58h_ b.1.1.0 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvesgaevkkpgssvkvscrasgtfykyainwvrqapgqglewmggiipffgttnya
qkfqgrltitadgstntaymqldslrsedtavyycagpsiteshycldcaakdyyygldv
wgqgttvtvssastkgpsvfplaptaalgclvkdyfpepvtvswnsgaltsgvhtfpavl
qssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkrvep

SCOPe Domain Coordinates for d4o58h_:

Click to download the PDB-style file with coordinates for d4o58h_.
(The format of our PDB-style files is described here.)

Timeline for d4o58h_:

  • d4o58h_ is new in SCOPe 2.08-stable