Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.114: 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain [55815] (1 superfamily) core: alpha-beta(2)-alpha-beta(2)-alpha-beta; 3 layers; mixed sheet: order 31425 |
Superfamily d.114.1: 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain [55816] (2 families) |
Family d.114.1.1: 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain [55817] (1 protein) |
Protein 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain [55818] (3 species) |
Species Escherichia coli [TaxId:562] [55819] (8 PDB entries) Uniprot P07024 26-550 |
Domain d2ushb1: 2ush B:363-549 [40925] Other proteins in same PDB: d2usha2, d2ushb2 complexed with wo4, zn |
PDB Entry: 2ush (more details), 2.22 Å
SCOPe Domain Sequences for d2ushb1:
Sequence, based on SEQRES records: (download)
>d2ushb1 d.114.1.1 (B:363-549) 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain {Escherichia coli [TaxId: 562]} kigetngrlegdrdkvrfvqtnmgrlilaaqmdrtgadfavmsgggirdsieagdisykn vlkvqpfgnvvvyadmtgkevidyltavaqmkpdsgaypqfanvsfvakdgklndlkikg epvdpaktyrmatlnfnatggdgyprldnkpgyvntgfidaevlkayiqksspldvsvye pkgevsw
>d2ushb1 d.114.1.1 (B:363-549) 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain {Escherichia coli [TaxId: 562]} kigetngrlegdrdkvrfvqtnmgrlilaaqmdrtgadfavmsgggirdsieagdisykn vlkvqpfgnvvvyadmtgkevidyltavaqmkpdsgaypqfanvsfvklndlkikgepvd paktyrmatlnfnatggdgyprldnkpgyvntgfidaevlkayiqksspldvsvyepkge vsw
Timeline for d2ushb1: