Lineage for d4nnph_ (4nnp H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742214Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)
  8. 2743437Domain d4nnph_: 4nnp H: [409248]
    Other proteins in same PDB: d4nnpa_, d4nnpb_, d4nnpl1, d4nnpl2, d4nnpy1, d4nnpy2
    automated match to d6shgh_

Details for d4nnph_

PDB Entry: 4nnp (more details), 2.69 Å

PDB Description: crystal structure of apo manganese abc transporter mntc from staphylococcus aureus bound to an antagonistic fab fragment
PDB Compounds: (H:) Heavy chain of antagonistic fab fragment

SCOPe Domain Sequences for d4nnph_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nnph_ b.1.1.1 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qlvesggglvqpggslrlscaasgfnfssssihwvrqapgkglewvasiysysgytyyad
svkgrftisadtskntaylqmnslraedtavyycarqssaeieswyyysgeamdywgqgt
lvtvssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfp
avlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk

SCOPe Domain Coordinates for d4nnph_:

Click to download the PDB-style file with coordinates for d4nnph_.
(The format of our PDB-style files is described here.)

Timeline for d4nnph_:

  • d4nnph_ is new in SCOPe 2.08-stable