SCOPe 2.08: Domain d4nkqc1: 4nkq C:14-110

Lineage for d4nkqc1 (4nkq C:14-110)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (4 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.2: Short-chain cytokines [47286] (14 proteins)

6. Protein Granulocyte-macrophage colony-stimulating factor (GM-CSF) [47289] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47290] (10 PDB entries)

8. Domain d4nkqc1: 4nkq C:14-110 [409242]
   Other proteins in same PDB: d4nkqb1, d4nkqb2, d4nkqc2
   complexed with nag

Details for d4nkqc1

PDB Entry: 4nkq, 3.3 Å

PDB Description: structure of a cytokine receptor complex

PDB Compounds: (C:) granulocyte-macrophage colony-stimulating factor

SCOPe Domain Sequences for d4nkqc1:

Sequence; same for both SEQRES and ATOM records:

>d4nkqc1 a.26.1.2 (C:14-110) Granulocyte-macrophage colony-stimulating factor (GM-CSF) {Human (Homo sapiens) [TaxId: 9606]}
ehvnaiqearrllnlsrdtaaemnetvevisemfdlqeptclqtrlelykqglrgsltkl
kgpltmmashykqhcpptpetscatqiitfesfkenl

Timeline for d4nkqc1:

• d4nkqc1 is new in SCOPe 2.08-stable