Lineage for d4nkqb2 (4nkq B:23-197)

  1. Root: SCOPe 2.08
  2. 3042554Class i: Low resolution protein structures [58117] (25 folds)
  3. 3044944Fold i.12: Proteins of incorrect, partial and unknown sequence [58207] (1 superfamily)
  4. 3044945Superfamily i.12.1: Proteins of incorrect, partial and unknown sequence [58208] (1 family) (S)
  5. 3044946Family i.12.1.1: Proteins of incorrect, partial and unknown sequence [58209] (12 proteins)
  6. 3044961Protein Granulocyte-macrophage colony-stimulating factor receptor alpha fragments [419235] (1 species)
  7. 3044962Species Human (Homo sapiens) [TaxId:9606] [419760] (1 PDB entry)
  8. 3044963Domain d4nkqb2: 4nkq B:23-197 [409241]
    Other proteins in same PDB: d4nkqb1, d4nkqc1, d4nkqc2
    complexed with nag

Details for d4nkqb2

PDB Entry: 4nkq (more details), 3.3 Å

PDB Description: structure of a cytokine receptor complex
PDB Compounds: (B:) Granulocyte-macrophage colony-stimulating factor receptor subunit alpha

SCOPe Domain Sequences for d4nkqb2:

Sequence, based on SEQRES records: (download)

>d4nkqb2 i.12.1.1 (B:23-197) Granulocyte-macrophage colony-stimulating factor receptor alpha fragments {Human (Homo sapiens) [TaxId: 9606]}
xxxxxxxxxxxxxxxxxnsgregtaaqnfscfiynadlmnctwargptaprdvqyflyir
nskrrreircpyyiqdsgthvgchldnlsgltsrnyflvngtsreigiqffdslldtkki
e

Sequence, based on observed residues (ATOM records): (download)

>d4nkqb2 i.12.1.1 (B:23-197) Granulocyte-macrophage colony-stimulating factor receptor alpha fragments {Human (Homo sapiens) [TaxId: 9606]}
xxxxxxxxxxxxxxxxxnsgregtaqnfscfiynadlmnctwargptdvqyflircpyyi
qdsgthvgchldnlsgltsrnyfslldtkkie

SCOPe Domain Coordinates for d4nkqb2:

Click to download the PDB-style file with coordinates for d4nkqb2.
(The format of our PDB-style files is described here.)

Timeline for d4nkqb2:

  • d4nkqb2 is new in SCOPe 2.08-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d4nkqb1