SCOPe 2.08: Domain d4nkqb2: 4nkq B:23-197

Lineage for d4nkqb2 (4nkq B:23-197)

1. Root: SCOPe 2.08

2. Class i: Low resolution protein structures [58117] (25 folds)

3. Fold i.12: Proteins of incorrect, partial and unknown sequence [58207] (1 superfamily)

4. Superfamily i.12.1: Proteins of incorrect, partial and unknown sequence [58208] (1 family)

5. Family i.12.1.1: Proteins of incorrect, partial and unknown sequence [58209] (12 proteins)

6. Protein Granulocyte-macrophage colony-stimulating factor receptor alpha fragments [419235] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [419760] (1 PDB entry)

8. Domain d4nkqb2: 4nkq B:23-197 [409241]
   Other proteins in same PDB: d4nkqb1, d4nkqc1, d4nkqc2
   complexed with nag

Details for d4nkqb2

PDB Entry: 4nkq, 3.3 Å

PDB Description: structure of a cytokine receptor complex

PDB Compounds: (B:) Granulocyte-macrophage colony-stimulating factor receptor subunit alpha

SCOPe Domain Sequences for d4nkqb2:

Sequence, based on SEQRES records:

>d4nkqb2 i.12.1.1 (B:23-197) Granulocyte-macrophage colony-stimulating factor receptor alpha fragments {Human (Homo sapiens) [TaxId: 9606]}
xxxxxxxxxxxxxxxxxnsgregtaaqnfscfiynadlmnctwargptaprdvqyflyir
nskrrreircpyyiqdsgthvgchldnlsgltsrnyflvngtsreigiqffdslldtkki
e

Sequence, based on observed residues (ATOM records):

>d4nkqb2 i.12.1.1 (B:23-197) Granulocyte-macrophage colony-stimulating factor receptor alpha fragments {Human (Homo sapiens) [TaxId: 9606]}
xxxxxxxxxxxxxxxxxnsgregtaqnfscfiynadlmnctwargptdvqyflircpyyi
qdsgthvgchldnlsgltsrnyfslldtkkie

Timeline for d4nkqb2:

• d4nkqb2 is new in SCOPe 2.08-stable