Lineage for d4nkqb1 (4nkq B:198-296)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2766890Superfamily b.1.29: Macroglobulin [254121] (9 families) (S)
    C3 MG domains possibly arose by gene duplication according to PubMed 16177781; PubMed 17608619; possibly related to immunoglobulins according to Pfam clan annotations
  5. 2766969Family b.1.29.9: Granulocyte-macrophage colony-stimulating factor receptor alpha-like [418874] (1 protein)
  6. 2766970Protein Granulocyte-macrophage colony-stimulating factor receptor alpha [419234] (1 species)
  7. 2766971Species Human (Homo sapiens) [TaxId:9606] [419759] (1 PDB entry)
  8. 2766972Domain d4nkqb1: 4nkq B:198-296 [409240]
    Other proteins in same PDB: d4nkqb2, d4nkqc1, d4nkqc2
    complexed with nag

Details for d4nkqb1

PDB Entry: 4nkq (more details), 3.3 Å

PDB Description: structure of a cytokine receptor complex
PDB Compounds: (B:) Granulocyte-macrophage colony-stimulating factor receptor subunit alpha

SCOPe Domain Sequences for d4nkqb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nkqb1 b.1.29.9 (B:198-296) Granulocyte-macrophage colony-stimulating factor receptor alpha {Human (Homo sapiens) [TaxId: 9606]}
rfnppsnvtvrcntthclvrwkqprtyqklsyldfqyqldvhrkntqpgtenllinvsgd
lenrynfpsseprakhsvkiraadvrilnwsswseaief

SCOPe Domain Coordinates for d4nkqb1:

Click to download the PDB-style file with coordinates for d4nkqb1.
(The format of our PDB-style files is described here.)

Timeline for d4nkqb1:

  • d4nkqb1 is new in SCOPe 2.08-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d4nkqb2