Lineage for d2usha1 (2ush A:363-549)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 35302Fold d.114: 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain [55815] (1 superfamily)
  4. 35303Superfamily d.114.1: 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain [55816] (1 family) (S)
  5. 35304Family d.114.1.1: 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain [55817] (1 protein)
  6. 35305Protein 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain [55818] (1 species)
  7. 35306Species Escherichia coli [TaxId:562] [55819] (2 PDB entries)
  8. 35308Domain d2usha1: 2ush A:363-549 [40924]
    Other proteins in same PDB: d2usha2, d2ushb2

Details for d2usha1

PDB Entry: 2ush (more details), 2.22 Å

PDB Description: 5'-nucleotidase from e. coli

SCOP Domain Sequences for d2usha1:

Sequence, based on SEQRES records: (download)

>d2usha1 d.114.1.1 (A:363-549) 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain {Escherichia coli}
kigetngrlegdrdkvrfvqtnmgrlilaaqmdrtgadfavmsgggirdsieagdisykn
vlkvqpfgnvvvyadmtgkevidyltavaqmkpdsgaypqfanvsfvakdgklndlkikg
epvdpaktyrmatlnfnatggdgyprldnkpgyvntgfidaevlkayiqksspldvsvye
pkgevsw

Sequence, based on observed residues (ATOM records): (download)

>d2usha1 d.114.1.1 (A:363-549) 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain {Escherichia coli}
kigetngrlegdrdkvrfvqtnmgrlilaaqmdrtgadfavmsgggirdsieagdisykn
vlkvqpfgnvvvyadmtgkevidyltavaqmkpdsgaypqfanvsfvakkikgepvdpak
tyrmatlnfnatggdgyprldnkpgyvntgfidaevlkayiqksspldvsvyepkgevsw

SCOP Domain Coordinates for d2usha1:

Click to download the PDB-style file with coordinates for d2usha1.
(The format of our PDB-style files is described here.)

Timeline for d2usha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2usha2