Lineage for d4nj9h1 (4nj9 H:1-226)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (23 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (610 PDB entries)
  8. 2744526Domain d4nj9h1: 4nj9 H:1-226 [409236]
    Other proteins in same PDB: d4nj9h2, d4nj9l1, d4nj9l2
    automated match to d6shgh_
    complexed with 2m9, zn

Details for d4nj9h1

PDB Entry: 4nj9 (more details), 1.95 Å

PDB Description: crystal structure of fab 8b10 in complex with mpts
PDB Compounds: (H:) 8B10 heavy chain

SCOPe Domain Sequences for d4nj9h1:

Sequence, based on SEQRES records: (download)

>d4nj9h1 b.1.1.1 (H:1-226) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evqlqqsgpelvkpgtsvkmsckasgytftdyymhwvkqshgkslewigyiypnnggngy
nqkfkgkatltvdkssstaymelrsltsedsavyycarrggygsrgyfdvwgtgttvtvs
sakttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpallqs
glytlsssvtvtsntwpsqtitcnvahpasstkvdkkiepr

Sequence, based on observed residues (ATOM records): (download)

>d4nj9h1 b.1.1.1 (H:1-226) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evqlqqsgpelvkpgtsvkmsckasgytftdyymhwvkqshgkslewigyiypnnggngy
nqkfkgkatltvdkssstaymelrsltsedsavyycarrggygsrgyfdvwgtgttvtvs
sakttapsvyplapvgssvtlgclvkgyfpepvtltwnsgslssgvhtfpallqsglytl
sssvtvtsntwpsqtitcnvahpasstkvdkkiepr

SCOPe Domain Coordinates for d4nj9h1:

Click to download the PDB-style file with coordinates for d4nj9h1.
(The format of our PDB-style files is described here.)

Timeline for d4nj9h1:

  • d4nj9h1 is new in SCOPe 2.08-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d4nj9h2