Lineage for d1ush_1 (1ush 363-550)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 35302Fold d.114: 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain [55815] (1 superfamily)
  4. 35303Superfamily d.114.1: 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain [55816] (1 family) (S)
  5. 35304Family d.114.1.1: 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain [55817] (1 protein)
  6. 35305Protein 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain [55818] (1 species)
  7. 35306Species Escherichia coli [TaxId:562] [55819] (2 PDB entries)
  8. 35307Domain d1ush_1: 1ush 363-550 [40923]
    Other proteins in same PDB: d1ush_2

Details for d1ush_1

PDB Entry: 1ush (more details), 1.73 Å

PDB Description: 5'-nucleotidase from e. coli

SCOP Domain Sequences for d1ush_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ush_1 d.114.1.1 (363-550) 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain {Escherichia coli}
kigetngrlegdrdkvrfvqtnmgrlilaaqmdrtgadfavmsgggirdsieagdisykn
vlkvqpfgnvvvyadmtgkevidyltavaqmkpdsgaypqfanvsfvakdgklndlkikg
epvdpaktyrmatlnfnatggdgyprldnkpgyvntgfidaevlkayiqksspldvsvye
pkgevswq

SCOP Domain Coordinates for d1ush_1:

Click to download the PDB-style file with coordinates for d1ush_1.
(The format of our PDB-style files is described here.)

Timeline for d1ush_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ush_2