Lineage for d1ush_1 (1ush 363-550)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.114: 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain [55815] (1 superfamily) Superfamily d.114.1: 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain [55816] (1 family) 
Family d.114.1.1: 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain [55817] (1 protein) Protein 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain [55818] (1 species) Species Escherichia coli [TaxId:562] [55819] (2 PDB entries) 
Domain d1ush_1: 1ush 363-550 [40923]
Other proteins in same PDB: d1ush_2
Details for d1ush_1
PDB Entry: 1ush (more details), 1.73 Å
PDB Description: 5'-nucleotidase from e. coli
SCOP Domain Sequences for d1ush_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ush_1 d.114.1.1 (363-550) 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain {Escherichia coli}
kigetngrlegdrdkvrfvqtnmgrlilaaqmdrtgadfavmsgggirdsieagdisykn
vlkvqpfgnvvvyadmtgkevidyltavaqmkpdsgaypqfanvsfvakdgklndlkikg
epvdpaktyrmatlnfnatggdgyprldnkpgyvntgfidaevlkayiqksspldvsvye
pkgevswq
SCOP Domain Coordinates for d1ush_1:
Click to download the PDB-style file with coordinates for d1ush_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ush_1:
- d1ush_1 appears in SCOP 1.57
- d1ush_1 appears in the current release, SCOPe 2.07, called d1usha1
View in 3D
