SCOP 1.71: Domain d1tum__: 1tum -

Lineage for d1tum__ (1tum -)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.113: Nudix [55810] (1 superfamily)
   beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
   contains beta-grasp motif

4. Superfamily d.113.1: Nudix [55811] (5 families)

5. Family d.113.1.1: MutT-like [55812] (10 proteins)

6. Protein Nucleoside triphosphate pyrophosphorylase (MutT) [55813] (1 species)

7. Species Escherichia coli [TaxId:562] [55814] (6 PDB entries)

8. Domain d1tum__: 1tum - [40922]
   complexed with apc, con, mo2; mutant

Details for d1tum__

PDB Entry: 1tum

PDB Description: mutt pyrophosphohydrolase-metal-nucleotide-metal complex, nmr, 16 structures

SCOP Domain Sequences for d1tum__:

Sequence; same for both SEQRES and ATOM records:

>d1tum__ d.113.1.1 (-) Nucleoside triphosphate pyrophosphorylase (MutT) {Escherichia coli}
mkklqiavgiirnenneifitrraadahmanklefpggkiemgetpeqavvrelqeevgi
tpqhfslfekleyefpdrhitlwfwlverwegepwgkegqpgewmslvglnaddfppane
pviaklkrl

Timeline for d1tum__:

• d1tum__ first appeared (with stable ids) in SCOP 1.55
  
• d1tum__ appears in SCOP 1.69
  
• d1tum__ is called d1tuma_ in SCOP 1.73
  
• d1tum__ appears in the current release, SCOPe 2.08, called d1tuma_