Lineage for d1muta_ (1mut A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2577867Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 2577868Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 2577869Family d.113.1.1: MutT-like [55812] (17 proteins)
  6. 2578129Protein Nucleoside triphosphate pyrophosphorylase (MutT) [55813] (3 species)
  7. 2578136Species Escherichia coli [TaxId:562] [55814] (6 PDB entries)
  8. 2578141Domain d1muta_: 1mut A: [40921]

Details for d1muta_

PDB Entry: 1mut (more details)

PDB Description: nmr study of mutt enzyme, a nucleoside triphosphate pyrophosphohydrolase
PDB Compounds: (A:) nucleoside triphosphate pyrophosphohydrolase

SCOPe Domain Sequences for d1muta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1muta_ d.113.1.1 (A:) Nucleoside triphosphate pyrophosphorylase (MutT) {Escherichia coli [TaxId: 562]}
mkklqiavgiirnenneifitrraadahmanklefpggkiemgetpeqavvrelqeevgi
tpqhfslfekleyefpdrhitlwfwlverwegepwgkegqpgewmslvglnaddfppane
pviaklkrl

SCOPe Domain Coordinates for d1muta_:

Click to download the PDB-style file with coordinates for d1muta_.
(The format of our PDB-style files is described here.)

Timeline for d1muta_: