Lineage for d1a3ac_ (1a3a C:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 83289Fold d.112: Phoshotransferase/anion transport protein [55803] (1 superfamily)
  4. 83290Superfamily d.112.1: Phoshotransferase/anion transport protein [55804] (2 families) (S)
  5. 83291Family d.112.1.1: IIA domain of mannitol-specific and ntr phosphotransferase EII [55805] (2 proteins)
  6. 83296Protein Phosphotransferase IIa-mannitol [55808] (1 species)
  7. 83297Species Escherichia coli [TaxId:562] [55809] (1 PDB entry)
  8. 83300Domain d1a3ac_: 1a3a C: [40919]

Details for d1a3ac_

PDB Entry: 1a3a (more details), 1.8 Å

PDB Description: crystal structure of iia mannitol from escherichia coli

SCOP Domain Sequences for d1a3ac_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a3ac_ d.112.1.1 (C:) Phosphotransferase IIa-mannitol {Escherichia coli}
nlfklgaeniflgrkaatkeeairfageqlvkggyvepeyvqamldrekltptylgesia
vphgtveakdrvlktgvvfcqypegvrfgeeeddiarlvigiaarnnehiqvitsltnal
ddesvierlahttsvdevlellagrk

SCOP Domain Coordinates for d1a3ac_:

Click to download the PDB-style file with coordinates for d1a3ac_.
(The format of our PDB-style files is described here.)

Timeline for d1a3ac_: