Lineage for d4ma1b_ (4ma1 B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
  8. 2744591Domain d4ma1b_: 4ma1 B: [409186]
    Other proteins in same PDB: d4ma1c2, d4ma1f2, d4ma1l2
    automated match to d6shgh_
    complexed with k, peg

Details for d4ma1b_

PDB Entry: 4ma1 (more details), 2.32 Å

PDB Description: unliganded 3 crystal structure of s25-26 fab
PDB Compounds: (B:) S25-26 Fab (Igg1k) Heavy Chain

SCOPe Domain Sequences for d4ma1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ma1b_ b.1.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evqlkesgpglvqpsqslsitctvsgfslttygvhwvrqspgkglewlgviwsggstdyn
aafisrlsiskdnskshvffkmnslqandtaiyycarmrittdwfaywgqgtlvtvsaak
ttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdly
tlsssvtvpsstwpsetvtcnvahpasstkvdkkivpr

SCOPe Domain Coordinates for d4ma1b_:

Click to download the PDB-style file with coordinates for d4ma1b_.
(The format of our PDB-style files is described here.)

Timeline for d4ma1b_:

  • d4ma1b_ is new in SCOPe 2.08-stable