Lineage for d1a3ab_ (1a3a B:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 609699Fold d.112: Phoshotransferase/anion transport protein [55803] (1 superfamily)
    beta-alpha(2)-beta(3)-alpha(3); 3 layers, alpha/beta/alpha; mixed sheet: order 1342; loop crossing
  4. 609700Superfamily d.112.1: Phoshotransferase/anion transport protein [55804] (2 families) (S)
  5. 609701Family d.112.1.1: IIA domain of mannitol-specific and ntr phosphotransferase EII [55805] (3 proteins)
  6. 609706Protein Phosphotransferase IIa-mannitol [55808] (1 species)
  7. 609707Species Escherichia coli [TaxId:562] [55809] (2 PDB entries)
  8. 609709Domain d1a3ab_: 1a3a B: [40918]

Details for d1a3ab_

PDB Entry: 1a3a (more details), 1.8 Å

PDB Description: crystal structure of iia mannitol from escherichia coli

SCOP Domain Sequences for d1a3ab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a3ab_ d.112.1.1 (B:) Phosphotransferase IIa-mannitol {Escherichia coli}
fklgaeniflgrkaatkeeairfageqlvkggyvepeyvqamldrekltptylgesiavp
hgtveakdrvlktgvvfcqypegvrfgeeeddiarlvigiaarnnehiqvitsltnaldd
esvierlahttsvdevlella

SCOP Domain Coordinates for d1a3ab_:

Click to download the PDB-style file with coordinates for d1a3ab_.
(The format of our PDB-style files is described here.)

Timeline for d1a3ab_: