Lineage for d4m6oh1 (4m6o H:1-226)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742214Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)
  8. 2743177Domain d4m6oh1: 4m6o H:1-226 [409177]
    Other proteins in same PDB: d4m6oh2, d4m6ol1, d4m6ol2
    automated match to d6shgh_
    complexed with mes, ni, so4

Details for d4m6oh1

PDB Entry: 4m6o (more details), 2.8 Å

PDB Description: Crystal structure of anti-NGF antibody CNTO7309
PDB Compounds: (H:) CNTO7309 heavy chain

SCOPe Domain Sequences for d4m6oh1:

Sequence, based on SEQRES records: (download)

>d4m6oh1 b.1.1.1 (H:1-226) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvesggglvqpggslrlscaasgftlrsysmnwvrqapgkglewvsyisrsshtify
adsvkgrftisrdnaknslylqmdslrdedtamyycarvyssgwhvsdyfdywgqgilvt
vssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavl
qssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc

Sequence, based on observed residues (ATOM records): (download)

>d4m6oh1 b.1.1.1 (H:1-226) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvesggglvqpggslrlscaasgftlrsysmnwvrqapgkglewvsyisrsshtify
adsvkgrftisrdnaknslylqmdslrdedtamyycarvyssgwhvsdyfdywgqgilvt
vssastkgpsvfplapssgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgl
yslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc

SCOPe Domain Coordinates for d4m6oh1:

Click to download the PDB-style file with coordinates for d4m6oh1.
(The format of our PDB-style files is described here.)

Timeline for d4m6oh1:

  • d4m6oh1 is new in SCOPe 2.08-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d4m6oh2