Lineage for d4lmqe_ (4lmq E:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742214Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)
  8. 2743467Domain d4lmqe_: 4lmq E: [409152]
    Other proteins in same PDB: d4lmqd_, d4lmqf_, d4lmqi1, d4lmqi2, d4lmql1, d4lmql2
    automated match to d6shgh_

Details for d4lmqe_

PDB Entry: 4lmq (more details), 2.77 Å

PDB Description: development and preclinical characterization of a humanized antibody targeting cxcl12
PDB Compounds: (E:) immunoglobulin G1 heavy chain

SCOPe Domain Sequences for d4lmqe_:

Sequence, based on SEQRES records: (download)

>d4lmqe_ b.1.1.1 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvesggglvqpggslrlscaasgfsltvysvhwvrqapgkglewvgalwgsggteyn
snlksrftisrdtskntvylqmnslraedtavyycardqglnygslfdywgqgtlvtvss
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvep

Sequence, based on observed residues (ATOM records): (download)

>d4lmqe_ b.1.1.1 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvesggglvqpggslrlscaasgfsltvysvhwvrqapgkglewvgalwgsggteyn
snlksrftisrdtskntvylqmnslraedtavyycardqglnygslfdywgqgtlvtvss
asgpsvfplalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssvvyicnv
nhkpsntkvdkkvep

SCOPe Domain Coordinates for d4lmqe_:

Click to download the PDB-style file with coordinates for d4lmqe_.
(The format of our PDB-style files is described here.)

Timeline for d4lmqe_:

  • d4lmqe_ is new in SCOPe 2.08-stable