Lineage for d4lluc_ (4llu C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742214Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)
  8. 2742915Domain d4lluc_: 4llu C: [409148]
    Other proteins in same PDB: d4llub1, d4llub2, d4llud1, d4llud2
    automated match to d6shgh_
    complexed with act, so4

Details for d4lluc_

PDB Entry: 4llu (more details), 2.16 Å

PDB Description: structure of pertuzumab fab with light chain clambda at 2.16a
PDB Compounds: (C:) Pertuzumab Fab heavy chain

SCOPe Domain Sequences for d4lluc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lluc_ b.1.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvesggglvqpggslrlscaasgftftdytmdwvrqapgkglewvadvnpnsggsiy
nqrfkgrftlsvdrskntlylqmnslraedtavyycarnlgpsfyfdywgqgtlvtvssa
stkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssg
lyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk

SCOPe Domain Coordinates for d4lluc_:

Click to download the PDB-style file with coordinates for d4lluc_.
(The format of our PDB-style files is described here.)

Timeline for d4lluc_:

  • d4lluc_ is new in SCOPe 2.08-stable