![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.111: PR-1-like [55796] (1 superfamily) alpha-beta-alpha-beta-alpha(2)-beta(2); 3 layers, alpha/beta/alpha; mixed sheet: order 1342 |
![]() | Superfamily d.111.1: PR-1-like [55797] (2 families) ![]() |
![]() | Family d.111.1.1: PR-1-like [55798] (5 proteins) Pfam PF00188; groups mammalian SCP/TPX1; insects AG3/AG5; fungi SC7/SC14 and plant PR-1 |
![]() | Protein Insect allergen 5 (AG5) [55801] (1 species) |
![]() | Species Yellow jacket (Vespula vulgaris), Ves v 5 [TaxId:7454] [55802] (1 PDB entry) |
![]() | Domain d1qnxa_: 1qnx A: [40914] complexed with na |
PDB Entry: 1qnx (more details), 1.9 Å
SCOPe Domain Sequences for d1qnxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qnxa_ d.111.1.1 (A:) Insect allergen 5 (AG5) {Yellow jacket (Vespula vulgaris), Ves v 5 [TaxId: 7454]} aeaefnnyckikclkggvhtackygslkpncgnkvvvsygltkqekqdilkehndfrqki argletrgnpgpqppaknmknlvwndelayvaqvwanqcqyghdtcrdvakyqvgqnval tgstaakyddpvklvkmwedevkdynpkkkfsgndflktghytqmvwantkevgcgsiky iqekwhkhylvcnygpsgnfkneelyqtk
Timeline for d1qnxa_: