Lineage for d1qnxa_ (1qnx A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2211337Fold d.111: PR-1-like [55796] (1 superfamily)
    alpha-beta-alpha-beta-alpha(2)-beta(2); 3 layers, alpha/beta/alpha; mixed sheet: order 1342
  4. 2211338Superfamily d.111.1: PR-1-like [55797] (2 families) (S)
  5. 2211339Family d.111.1.1: PR-1-like [55798] (5 proteins)
    Pfam PF00188; groups mammalian SCP/TPX1; insects AG3/AG5; fungi SC7/SC14 and plant PR-1
  6. 2211346Protein Insect allergen 5 (AG5) [55801] (1 species)
  7. 2211347Species Yellow jacket (Vespula vulgaris), Ves v 5 [TaxId:7454] [55802] (1 PDB entry)
  8. 2211348Domain d1qnxa_: 1qnx A: [40914]
    complexed with na

Details for d1qnxa_

PDB Entry: 1qnx (more details), 1.9 Å

PDB Description: ves v 5, an allergen from vespula vulgaris venom
PDB Compounds: (A:) ves v 5

SCOPe Domain Sequences for d1qnxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qnxa_ d.111.1.1 (A:) Insect allergen 5 (AG5) {Yellow jacket (Vespula vulgaris), Ves v 5 [TaxId: 7454]}
aeaefnnyckikclkggvhtackygslkpncgnkvvvsygltkqekqdilkehndfrqki
argletrgnpgpqppaknmknlvwndelayvaqvwanqcqyghdtcrdvakyqvgqnval
tgstaakyddpvklvkmwedevkdynpkkkfsgndflktghytqmvwantkevgcgsiky
iqekwhkhylvcnygpsgnfkneelyqtk

SCOPe Domain Coordinates for d1qnxa_:

Click to download the PDB-style file with coordinates for d1qnxa_.
(The format of our PDB-style files is described here.)

Timeline for d1qnxa_: