Lineage for d1cfe__ (1cfe -)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.111: PR-1-like [55796] (1 superfamily) Superfamily d.111.1: PR-1-like [55797] (1 family) 
Family d.111.1.1: PR-1-like [55798] (2 proteins) 
Protein Pathogenesis-related protein 1 (PR1) [55799] (1 species) Species Tomato (Lycopersicon esculentum), P14a [TaxId:4081] [55800] (1 PDB entry) 
Domain d1cfe__: 1cfe - [40913]
Details for d1cfe__
PDB Entry: 1cfe (more details)
PDB Description: p14a, nmr, 20 structures
SCOP Domain Sequences for d1cfe__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cfe__ d.111.1.1 (-) Pathogenesis-related protein 1 (PR1) {Tomato (Lycopersicon esculentum), P14a}
qnspqdylavhndaraqvgvgpmswdanlasraqnyansragdcnlihsgagenlakggg
dftgraavqlwvserpsynyatnqcvggkkcrhytqvvwrnsvrlgcgrarcnngwwfis
cnydpvgnwigqrpy
SCOP Domain Coordinates for d1cfe__:
Click to download the PDB-style file with coordinates for d1cfe__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1cfe__:
- d1cfe__ appears in SCOP 1.57
- d1cfe__ appears in the current release, SCOPe 2.08, called d1cfea_
View in 3D