Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.111: PR-1-like [55796] (1 superfamily) alpha-beta-alpha-beta-alpha(2)-beta(2); 3 layers, alpha/beta/alpha; mixed sheet: order 1342 |
Superfamily d.111.1: PR-1-like [55797] (2 families) |
Family d.111.1.1: PR-1-like [55798] (5 proteins) Pfam PF00188; groups mammalian SCP/TPX1; insects AG3/AG5; fungi SC7/SC14 and plant PR-1 |
Protein Pathogenesis-related protein 1 (PR1) [55799] (1 species) |
Species Tomato (Lycopersicon esculentum), P14a [TaxId:4081] [55800] (1 PDB entry) |
Domain d1cfea_: 1cfe A: [40913] |
PDB Entry: 1cfe (more details)
SCOPe Domain Sequences for d1cfea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cfea_ d.111.1.1 (A:) Pathogenesis-related protein 1 (PR1) {Tomato (Lycopersicon esculentum), P14a [TaxId: 4081]} qnspqdylavhndaraqvgvgpmswdanlasraqnyansragdcnlihsgagenlakggg dftgraavqlwvserpsynyatnqcvggkkcrhytqvvwrnsvrlgcgrarcnngwwfis cnydpvgnwigqrpy
Timeline for d1cfea_: