Lineage for d1cfea_ (1cfe A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2971194Fold d.111: PR-1-like [55796] (1 superfamily)
    alpha-beta-alpha-beta-alpha(2)-beta(2); 3 layers, alpha/beta/alpha; mixed sheet: order 1342
  4. 2971195Superfamily d.111.1: PR-1-like [55797] (2 families) (S)
  5. 2971196Family d.111.1.1: PR-1-like [55798] (5 proteins)
    Pfam PF00188; groups mammalian SCP/TPX1; insects AG3/AG5; fungi SC7/SC14 and plant PR-1
  6. 2971206Protein Pathogenesis-related protein 1 (PR1) [55799] (1 species)
  7. 2971207Species Tomato (Lycopersicon esculentum), P14a [TaxId:4081] [55800] (1 PDB entry)
  8. 2971208Domain d1cfea_: 1cfe A: [40913]

Details for d1cfea_

PDB Entry: 1cfe (more details)

PDB Description: p14a, nmr, 20 structures
PDB Compounds: (A:) pathogenesis-related protein p14a

SCOPe Domain Sequences for d1cfea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cfea_ d.111.1.1 (A:) Pathogenesis-related protein 1 (PR1) {Tomato (Lycopersicon esculentum), P14a [TaxId: 4081]}
qnspqdylavhndaraqvgvgpmswdanlasraqnyansragdcnlihsgagenlakggg
dftgraavqlwvserpsynyatnqcvggkkcrhytqvvwrnsvrlgcgrarcnngwwfis
cnydpvgnwigqrpy

SCOPe Domain Coordinates for d1cfea_:

Click to download the PDB-style file with coordinates for d1cfea_.
(The format of our PDB-style files is described here.)

Timeline for d1cfea_: