Lineage for d4kkcc_ (4kkc C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
  8. 2745315Domain d4kkcc_: 4kkc C: [409114]
    Other proteins in same PDB: d4kkca_, d4kkcb_, d4kkcd1, d4kkcd2, d4kkcf1, d4kkcf2
    automated match to d6shgh_
    mutant

Details for d4kkcc_

PDB Entry: 4kkc (more details), 3.18 Å

PDB Description: Structure of the E148A mutant of CLC-ec1 deltaNC construct in 20mM Bromide
PDB Compounds: (C:) Fab, heavy chain

SCOPe Domain Sequences for d4kkcc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kkcc_ b.1.1.1 (C:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vrllesggglvqpggslklscaasgfdysrywmswvrqapgkglkwigeinpvsstinyt
pslkdkfiisrdnakdtlylqiskvrsedtalyycarlyygygywyfdvwgagttvtvss
akttppsvyplapgsaaaaasmvtlgclvkgyfpepvtvtwnsgslaagvhtfpavlqaa
lytlsssvtvpssswpsetvtcnvahpasstkvdkkivpra

SCOPe Domain Coordinates for d4kkcc_:

Click to download the PDB-style file with coordinates for d4kkcc_.
(The format of our PDB-style files is described here.)

Timeline for d4kkcc_:

  • d4kkcc_ is new in SCOPe 2.08-stable