Lineage for d4kkae_ (4kka E:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
  8. 2745241Domain d4kkae_: 4kka E: [409111]
    Other proteins in same PDB: d4kkaa_, d4kkab_, d4kkad1, d4kkad2, d4kkaf1, d4kkaf2
    automated match to d6shgh_
    mutant

Details for d4kkae_

PDB Entry: 4kka (more details), 3 Å

PDB Description: Structure of the E148A mutant of CLC-ec1 deltaNC construct in 100mM fluoride and 20mM Bromide
PDB Compounds: (E:) Fab, heavy chain

SCOPe Domain Sequences for d4kkae_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kkae_ b.1.1.1 (E:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vrllesggglvqpggslklscaasgfdysrywmswvrqapgkglkwigeinpvsstinyt
pslkdkfiisrdnakdtlylqiskvrsedtalyycarlyygygywyfdvwgagttvtvss
akttppsvyplapgsaaaaasmvtlgclvkgyfpepvtvtwnsgslaagvhtfpavlqaa
lytlsssvtvpssswpsetvtcnvahpasstkvdkkivpra

SCOPe Domain Coordinates for d4kkae_:

Click to download the PDB-style file with coordinates for d4kkae_.
(The format of our PDB-style files is described here.)

Timeline for d4kkae_:

  • d4kkae_ is new in SCOPe 2.08-stable