Lineage for d4ki5c_ (4ki5 C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
  8. 2744711Domain d4ki5c_: 4ki5 C: [409099]
    Other proteins in same PDB: d4ki5d1, d4ki5d2, d4ki5e1, d4ki5e2, d4ki5f1, d4ki5f2, d4ki5m_
    automated match to d6shgh_

Details for d4ki5c_

PDB Entry: 4ki5 (more details), 2.47 Å

PDB Description: Cystal structure of human factor VIII C2 domain in a ternary complex with murine inhbitory antibodies 3E6 and G99
PDB Compounds: (C:) murine monoclonal 3e6 fab heavy chain

SCOPe Domain Sequences for d4ki5c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ki5c_ b.1.1.1 (C:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iqlvqsgpelkkpgktvkisckasdytftdyslhwvkqapgkglkwmgwintetgdpaya
ddfkgrfafsletsvrtaylqinnlknedtaiyfcareddglaswgqgttltvssaktta
psvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytls
ssvtvtsstwpsqsitcnvahpasstkvdkkieprgpa

SCOPe Domain Coordinates for d4ki5c_:

Click to download the PDB-style file with coordinates for d4ki5c_.
(The format of our PDB-style files is described here.)

Timeline for d4ki5c_:

  • d4ki5c_ is new in SCOPe 2.08-stable