Lineage for d4k2uh_ (4k2u H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
  8. 2744953Domain d4k2uh_: 4k2u H: [409093]
    Other proteins in same PDB: d4k2ua_, d4k2ub_, d4k2ul1, d4k2ul2, d4k2um1, d4k2um2
    automated match to d6shgh_
    complexed with so4

Details for d4k2uh_

PDB Entry: 4k2u (more details), 2.45 Å

PDB Description: crystal structure of pfeba-175 f1 in complex with r218 antibody fab fragment
PDB Compounds: (H:) antibody heavy chain

SCOPe Domain Sequences for d4k2uh_:

Sequence, based on SEQRES records: (download)

>d4k2uh_ b.1.1.1 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evqlqqsgaelvkpgasvklsctasgfnikdnymhwvkqrpeqglewigridpangntky
dpkfqgkatitadtssntaylqlssltsedtavyycarhydgyflyyfeywgqgttltvs
sakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqs
dlytlsssvtvpsstwpsetvtcnvahpasstkvdkkivp

Sequence, based on observed residues (ATOM records): (download)

>d4k2uh_ b.1.1.1 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evqlqqsgaelvkpgasvklsctasgfnikdnymhwvkqrplewigridpangntkydpk
fqgkatitadtssntaylqlssltsedtavyycarhydgyflyyfeywgqgttltvssak
ttppsvyplapvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsssvtvp
sstwpsetvtcnvahpasstkvdkkivp

SCOPe Domain Coordinates for d4k2uh_:

Click to download the PDB-style file with coordinates for d4k2uh_.
(The format of our PDB-style files is described here.)

Timeline for d4k2uh_:

  • d4k2uh_ is new in SCOPe 2.08-stable