Lineage for d4jqih_ (4jqi H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
  8. 2744869Domain d4jqih_: 4jqi H: [409076]
    Other proteins in same PDB: d4jqia1, d4jqil1, d4jqil2
    automated match to d6shgh_
    complexed with cl, edo, pro

Details for d4jqih_

PDB Entry: 4jqi (more details), 2.6 Å

PDB Description: Structure of active beta-arrestin1 bound to a G protein-coupled receptor phosphopeptide
PDB Compounds: (H:) Fab30 heavy chain

SCOPe Domain Sequences for d4jqih_:

Sequence, based on SEQRES records: (download)

>d4jqih_ b.1.1.1 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vqlvesggglvqpggslrlscaasgfnvysssihwvrqapgkglewvasissyygytyya
dsvkgrftisadtskntaylqmnslraedtavyycarsrqfwysgldywgqgtlvtvssa
stkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssg
lyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvep

Sequence, based on observed residues (ATOM records): (download)

>d4jqih_ b.1.1.1 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vqlvesggglvqpggslrlscaasgfnvysssihwvrqapgkglewvasissyygytyya
dsvkgrftisadtskntaylqmnslraedtavyycarsrqfwysgldywgqgtlvtvssa
stkgpsvfplapaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssvvt
vpssyicnvnhkpsntkvdkkvep

SCOPe Domain Coordinates for d4jqih_:

Click to download the PDB-style file with coordinates for d4jqih_.
(The format of our PDB-style files is described here.)

Timeline for d4jqih_:

  • d4jqih_ is new in SCOPe 2.08-stable