Lineage for d1dp6a_ (1dp6 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2970038Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2970344Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 2970442Family d.110.3.2: Heme-binding PAS domain [55789] (3 proteins)
  6. 2970455Protein Histidine kinase FixL heme domain [55790] (2 species)
  7. 2970456Species Bradyrhizobium japonicum [TaxId:375] [55792] (19 PDB entries)
    Uniprot P23222 152-270
  8. 2970483Domain d1dp6a_: 1dp6 A: [40907]
    complexed with hem, oxy

Details for d1dp6a_

PDB Entry: 1dp6 (more details), 2.3 Å

PDB Description: oxygen-binding complex of fixl heme domain
PDB Compounds: (A:) fixl protein

SCOPe Domain Sequences for d1dp6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dp6a_ d.110.3.2 (A:) Histidine kinase FixL heme domain {Bradyrhizobium japonicum [TaxId: 375]}
damividghgiiqlfstaaerlfgwseleaigqnvnilmpepdrsrhdsyisryrttsdp
hiigigrivtgkrrdgttfpmhlsigemqsggepyftgfvrdltehqqtqarlqel

SCOPe Domain Coordinates for d1dp6a_:

Click to download the PDB-style file with coordinates for d1dp6a_.
(The format of our PDB-style files is described here.)

Timeline for d1dp6a_: