Lineage for d1d06a_ (1d06 A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 731578Fold d.110: Profilin-like [55769] (9 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 731664Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (6 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 731715Family d.110.3.2: Heme-binding PAS domain [55789] (2 proteins)
  6. 731728Protein Histidine kinase FixL heme domain [55790] (2 species)
  7. 731747Species Rhizobium meliloti [TaxId:382] [55791] (2 PDB entries)
  8. 731749Domain d1d06a_: 1d06 A: [40906]
    complexed with hem; mutant

Details for d1d06a_

PDB Entry: 1d06 (more details), 1.4 Å

PDB Description: structural basis of dimerization and sensory mechanisms of oxygen- sensing domain of rhizobium meliloti fixl determined at 1.4a resolution
PDB Compounds: (A:) nitrogen fixation regulatory protein fixL

SCOP Domain Sequences for d1d06a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d06a_ d.110.3.2 (A:) Histidine kinase FixL heme domain {Rhizobium meliloti [TaxId: 382]}
gshmletedvvrardahlrsildtvpdatvvsatdgtivsfnaaavrqfgyaeeevigqn
lrilmpepyrhehdgylqrymatgekriigidrvvsgqrkdgstfpmklavgemrsgger
fftgfirdlt

SCOP Domain Coordinates for d1d06a_:

Click to download the PDB-style file with coordinates for d1d06a_.
(The format of our PDB-style files is described here.)

Timeline for d1d06a_: