Lineage for d1d06a_ (1d06 A:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 35199Fold d.110: Profilin-like [55769] (3 superfamilies)
  4. 35246Superfamily d.110.3: PYP-like sensor domain [55785] (3 families) (S)
  5. 35258Family d.110.3.2: Histidine kinase FixL heme domain [55789] (1 protein)
  6. 35259Protein Histidine kinase FixL heme domain [55790] (2 species)
  7. 35266Species Rhizobium meliloti [TaxId:382] [55791] (2 PDB entries)
  8. 35268Domain d1d06a_: 1d06 A: [40906]

Details for d1d06a_

PDB Entry: 1d06 (more details), 1.4 Å

PDB Description: structural basis of dimerization and sensory mechanisms of oxygen- sensing domain of rhizobium meliloti fixl determined at 1.4a resolution

SCOP Domain Sequences for d1d06a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d06a_ d.110.3.2 (A:) Histidine kinase FixL heme domain {Rhizobium meliloti}
gshmletedvvrardahlrsildtvpdatvvsatdgtivsfnaaavrqfgyaeeevigqn
lrilmpepyrhehdgylqrymatgekriigidrvvsgqrkdgstfpmklavgemrsgger
fftgfirdlt

SCOP Domain Coordinates for d1d06a_:

Click to download the PDB-style file with coordinates for d1d06a_.
(The format of our PDB-style files is described here.)

Timeline for d1d06a_: