Lineage for d4jm2a_ (4jm2 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2758475Domain d4jm2a_: 4jm2 A: [409058]
    Other proteins in same PDB: d4jm2b2, d4jm2c1, d4jm2c2, d4jm2e_, d4jm2f1, d4jm2f2
    automated match to d6shgh_
    complexed with nag, pg4

Details for d4jm2a_

PDB Entry: 4jm2 (more details), 3.1 Å

PDB Description: crystal structure of pgt 135 fab in complex with gp120 core protein from hiv-1 strain jr-fl bound to cd4 and 17b fab
PDB Compounds: (A:) PGT 135 Heavy Chain

SCOPe Domain Sequences for d4jm2a_:

Sequence, based on SEQRES records: (download)

>d4jm2a_ b.1.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qlqmqesgpglvkpsetlslsctvsgdsirggewgdkdyhwgwvrhsagkglewigsihw
rgtthykeslrrrvsmsidtsrnwfslrlasvtaadtavyfcarhrhhdvfmlvpiagwf
dvwgpgvqvtvssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgalt
sgvhtfpavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkrvepk

Sequence, based on observed residues (ATOM records): (download)

>d4jm2a_ b.1.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qlqmqesgpglvkpsetlslsctvsgdsirggewgdkdyhwgwvrhsagkglewigsihw
rgtthykeslrrrvsmsidtsrnwfslrlasvtaadtavyfcarhrhhdvfmlvpiagwf
dvwgpgvqvtvssastkgpsvfplapgtaalgclvkdyfpepvtvswnsgaltsgvhtfp
avlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkrvepk

SCOPe Domain Coordinates for d4jm2a_:

Click to download the PDB-style file with coordinates for d4jm2a_.
(The format of our PDB-style files is described here.)

Timeline for d4jm2a_:

  • d4jm2a_ is new in SCOPe 2.08-stable