Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (4 families) |
Family a.4.13.2: Sigma4 domain [88665] (5 proteins) |
Protein Sigma70 (SigA, RpoD) [88666] (4 species) Pfam PF03979 |
Species Escherichia coli [TaxId:562] [419561] (3 PDB entries) Uniprot P00579 546-613 |
Domain d4jk1x1: 4jk1 X:508-609 [409052] Other proteins in same PDB: d4jk1x2, d4jk1x3, d4jk1y2, d4jk1y3 protein/DNA complex; complexed with g4p, zn |
PDB Entry: 4jk1 (more details), 3.9 Å
SCOPe Domain Sequences for d4jk1x1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jk1x1 a.4.13.2 (X:508-609) Sigma70 (SigA, RpoD) {Escherichia coli [TaxId: 562]} etpigddedshlgdfiedttlelpldsatteslraathdvlagltareakvlrmrfgidm ntdytleevgkqfdvtrerirqieakalrklrhpsrsevlrs
Timeline for d4jk1x1: