Lineage for d4jk1x1 (4jk1 X:508-609)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2695832Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (4 families) (S)
  5. 2695870Family a.4.13.2: Sigma4 domain [88665] (5 proteins)
  6. 2695878Protein Sigma70 (SigA, RpoD) [88666] (4 species)
    Pfam PF03979
  7. 2695879Species Escherichia coli [TaxId:562] [419561] (3 PDB entries)
    Uniprot P00579 546-613
  8. 2695881Domain d4jk1x1: 4jk1 X:508-609 [409052]
    Other proteins in same PDB: d4jk1x2, d4jk1x3, d4jk1y2, d4jk1y3
    protein/DNA complex; complexed with g4p, zn

Details for d4jk1x1

PDB Entry: 4jk1 (more details), 3.9 Å

PDB Description: X-ray crystal structure of Escherichia coli sigma70 holoenzyme in complex with Guanosine tetraphosphate (ppGpp)
PDB Compounds: (X:) Escherichia coli RNA polymerase sigma70 subunit

SCOPe Domain Sequences for d4jk1x1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jk1x1 a.4.13.2 (X:508-609) Sigma70 (SigA, RpoD) {Escherichia coli [TaxId: 562]}
etpigddedshlgdfiedttlelpldsatteslraathdvlagltareakvlrmrfgidm
ntdytleevgkqfdvtrerirqieakalrklrhpsrsevlrs

SCOPe Domain Coordinates for d4jk1x1:

Click to download the PDB-style file with coordinates for d4jk1x1.
(The format of our PDB-style files is described here.)

Timeline for d4jk1x1:

  • d4jk1x1 is new in SCOPe 2.08-stable