Lineage for d1ew0a_ (1ew0 A:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 870642Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 870769Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (7 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 870823Family d.110.3.2: Heme-binding PAS domain [55789] (2 proteins)
  6. 870836Protein Histidine kinase FixL heme domain [55790] (2 species)
  7. 870855Species Rhizobium meliloti [TaxId:382] [55791] (2 PDB entries)
  8. 870856Domain d1ew0a_: 1ew0 A: [40905]
    complexed with hem

Details for d1ew0a_

PDB Entry: 1ew0 (more details), 1.4 Å

PDB Description: crystal structure analysis of the sensor domain of rmfixl(ferrous form)
PDB Compounds: (A:) fixl

SCOP Domain Sequences for d1ew0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ew0a_ d.110.3.2 (A:) Histidine kinase FixL heme domain {Rhizobium meliloti [TaxId: 382]}
gshmletedvvrardahlrsildtvpdatvvsatdgtivsfnaaavrqfgyaeeevigqn
lrilmpepyrhehdgylqrymatgekriigidrvvsgqrkdgstfpmklavgemrsgger
fftgfirdlt

SCOP Domain Coordinates for d1ew0a_:

Click to download the PDB-style file with coordinates for d1ew0a_.
(The format of our PDB-style files is described here.)

Timeline for d1ew0a_: