Lineage for d1ew0a_ (1ew0 A:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 83190Fold d.110: Profilin-like [55769] (4 superfamilies)
  4. 83237Superfamily d.110.3: PYP-like sensor domain [55785] (4 families) (S)
  5. 83249Family d.110.3.2: Histidine kinase FixL heme domain [55789] (1 protein)
  6. 83250Protein Histidine kinase FixL heme domain [55790] (2 species)
  7. 83257Species Rhizobium meliloti [TaxId:382] [55791] (2 PDB entries)
  8. 83258Domain d1ew0a_: 1ew0 A: [40905]

Details for d1ew0a_

PDB Entry: 1ew0 (more details), 1.4 Å

PDB Description: crystal structure analysis of the sensor domain of rmfixl(ferrous form)

SCOP Domain Sequences for d1ew0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ew0a_ d.110.3.2 (A:) Histidine kinase FixL heme domain {Rhizobium meliloti}
gshmletedvvrardahlrsildtvpdatvvsatdgtivsfnaaavrqfgyaeeevigqn
lrilmpepyrhehdgylqrymatgekriigidrvvsgqrkdgstfpmklavgemrsgger
fftgfirdlt

SCOP Domain Coordinates for d1ew0a_:

Click to download the PDB-style file with coordinates for d1ew0a_.
(The format of our PDB-style files is described here.)

Timeline for d1ew0a_: