Lineage for d4jfxh_ (4jfx H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742214Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)
  8. 2742609Domain d4jfxh_: 4jfx H: [409044]
    Other proteins in same PDB: d4jfxa1, d4jfxa2, d4jfxl1, d4jfxl2
    automated match to d6shgh_
    complexed with pg4

Details for d4jfxh_

PDB Entry: 4jfx (more details), 1.95 Å

PDB Description: structure of phosphotyrosine (ptyr) scaffold bound to ptyr peptide
PDB Compounds: (H:) Fab heavy chain

SCOPe Domain Sequences for d4jfxh_:

Sequence, based on SEQRES records: (download)

>d4jfxh_ b.1.1.1 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvesggglvqpggslrlscvtsgftfrkfgmswvrqapgkglewvasivtggrktyy
sdsvkgrftisrdnskntlylqmnslraedtavyyctrgysstsyamdywgqgtlvtvss
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepks

Sequence, based on observed residues (ATOM records): (download)

>d4jfxh_ b.1.1.1 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvesggglvqpggslrlscvtsgftfrkfgmswvrqapgkglewvasivtggrktyy
sdsvkgrftisrdnskntlylqmnslraedtavyyctrgysstsyamdywgqgtlvtvss
astkgpsvfplapsskggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgly
slssvvtvpssslgtqtyicnvnhkpsntkvdkkvepks

SCOPe Domain Coordinates for d4jfxh_:

Click to download the PDB-style file with coordinates for d4jfxh_.
(The format of our PDB-style files is described here.)

Timeline for d4jfxh_:

  • d4jfxh_ is new in SCOPe 2.08-stable