SCOP 1.69: Domain d3phy__: 3phy -

Lineage for d3phy__ (3phy -)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.110: Profilin-like [55769] (7 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (6 families)
   alpha-beta(2)-alpha(2)-beta(3)

5. Family d.110.3.1: PYP-like [55786] (2 proteins)

6. Protein Photoactive yellow protein, PYP [55787] (1 species)

7. Species Ectothiorhodospira halophila [TaxId:17] [55788] (27 PDB entries)

8. Domain d3phy__: 3phy - [40904]
   dark state (unbleached)

Details for d3phy__

PDB Entry: 3phy

PDB Description: photoactive yellow protein, dark state (unbleached), solution structure, nmr, 26 structures

SCOP Domain Sequences for d3phy__:

Sequence; same for both SEQRES and ATOM records:

>d3phy__ d.110.3.1 (-) Photoactive yellow protein, PYP {Ectothiorhodospira halophila}
mehvafgsedientlakmddgqldglafgaiqldgdgnilqynaaegditgrdpkqvigk
nffkdvapctdspefygkfkegvasgnlntmfeytfdyqmtptkvkvhmkkalsgdsywv
fvkrv

Timeline for d3phy__:

• d3phy__ first appeared (with stable ids) in SCOP 1.55
  
• d3phy__ appears in SCOP 1.67
  
• d3phy__ appears in SCOP 1.71
  
• d3phy__ appears in the current release, SCOPe 2.08, called d3phya_