Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (7 families) alpha-beta(2)-alpha(2)-beta(3) |
Family d.110.3.1: PYP-like [55786] (2 proteins) |
Protein Photoactive yellow protein, PYP [55787] (1 species) |
Species Ectothiorhodospira halophila [TaxId:17] [55788] (43 PDB entries) Uniprot P16113 |
Domain d2pyra_: 2pyr A: [40903] complexed with hc4 |
PDB Entry: 2pyr (more details), 1.9 Å
SCOP Domain Sequences for d2pyra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pyra_ d.110.3.1 (A:) Photoactive yellow protein, PYP {Ectothiorhodospira halophila [TaxId: 1053]} mehvafgsedientlakmddgqldglafgaiqldgdgnilqynaaegditgrdpkqvigk nffkdvapctdspefygkfkegvasgnlntmfeytfdyqmtptkvkvhmkkalsgdsywv fvkrv
Timeline for d2pyra_: