Lineage for d2pyp__ (2pyp -)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.110: Profilin-like [55769] (3 superfamilies) Superfamily d.110.3: PYP-like sensor domain [55785] (3 families) 
Family d.110.3.1: Photoactive yellow protein, PYP [55786] (1 protein) Protein Photoactive yellow protein, PYP [55787] (1 species) Species Ectothiorhodospira halophila [TaxId:17] [55788] (8 PDB entries) 
Domain d2pyp__: 2pyp - [40902]
Details for d2pyp__
PDB Entry: 2pyp (more details), 1.9 Å
PDB Description: photoactive yellow protein, photostationary state, 50% ground state, 50% bleached
SCOP Domain Sequences for d2pyp__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pyp__ d.110.3.1 (-) Photoactive yellow protein, PYP {Ectothiorhodospira halophila}
mehvafgsedientlakmddgqldglafgaiqldgdgnilqynaaegditgrdpkqvigk
nffkdvapctdspefygkfkegvasgnlntmfeytfdyqmtptkvkvhmkkalsgdsywv
fvkrv
SCOP Domain Coordinates for d2pyp__:
Click to download the PDB-style file with coordinates for d2pyp__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2pyp__:
- d2pyp__ appears in SCOP 1.57
- d2pyp__ appears in the current release, SCOPe 2.08, called d2pypa_
View in 3D