Lineage for d4i3sh_ (4i3s H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2758407Domain d4i3sh_: 4i3s H: [409017]
    Other proteins in same PDB: d4i3sl2
    automated match to d6shgh_
    complexed with ca

Details for d4i3sh_

PDB Entry: 4i3s (more details), 2.85 Å

PDB Description: crystal structure of the outer domain of hiv-1 gp120 in complex with vrc-pg04 space group p21
PDB Compounds: (H:) Heavy chain of VRC-PG04 Fab

SCOPe Domain Sequences for d4i3sh_:

Sequence, based on SEQRES records: (download)

>d4i3sh_ b.1.1.0 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvqlvqsgsgvkkpgasvrvscwtsedifertelihwvrqapgqglewigwvktvtgavn
fgspdfrqrvsltrdrdlftahmdirgltqgdtatyfcarqkfytggqgwyfdlwgrgtl
ivvssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpa
vlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepks

Sequence, based on observed residues (ATOM records): (download)

>d4i3sh_ b.1.1.0 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvqlvqsgsgvkkpgasvrvscwtsedifertelihwvrqapgqglewigwvktvtgavn
fgspdfrqrvsltrdrdlftahmdirgltqgdtatyfcarqkfytggqgwyfdlwgrgtl
ivvssastkgpsvfplapsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepks

SCOPe Domain Coordinates for d4i3sh_:

Click to download the PDB-style file with coordinates for d4i3sh_.
(The format of our PDB-style files is described here.)

Timeline for d4i3sh_:

  • d4i3sh_ is new in SCOPe 2.08-stable