Lineage for d4i2xb1 (4i2x B:1-222)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742214Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)
  8. 2742864Domain d4i2xb1: 4i2x B:1-222 [409013]
    Other proteins in same PDB: d4i2xa1, d4i2xa2, d4i2xb2, d4i2xc1, d4i2xc2
    automated match to d6shgh_
    complexed with cl, nag, zn

Details for d4i2xb1

PDB Entry: 4i2x (more details), 2.48 Å

PDB Description: crystal structure of signal regulatory protein gamma (sirp-gamma) in complex with fabox117
PDB Compounds: (B:) FabOX117 heavy chain

SCOPe Domain Sequences for d4i2xb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4i2xb1 b.1.1.1 (B:1-222) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evklqqsgpelvkpgasvkisckasgysftsyyihwvkqrpgqglewigwvfpgsgntky
nekfkgkatltadtssstaymqlssltsedsavyfcargnydrawfaywgqgtlvtvsaa
kttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdl
ytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdcg

SCOPe Domain Coordinates for d4i2xb1:

Click to download the PDB-style file with coordinates for d4i2xb1.
(The format of our PDB-style files is described here.)

Timeline for d4i2xb1:

  • d4i2xb1 is new in SCOPe 2.08-stable