Lineage for d4i2xb1 (4i2x B:1-222)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) Protein automated matches [190119] (24 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries) 
Domain d4i2xb1: 4i2x B:1-222 [409013]
Other proteins in same PDB: d4i2xa1, d4i2xa2, d4i2xb2, d4i2xc1, d4i2xc2
automated match to d6shgh_
complexed with cl, nag, zn
Details for d4i2xb1
PDB Entry: 4i2x (more details), 2.48 Å
PDB Description: crystal structure of signal regulatory protein gamma (sirp-gamma) in complex with fabox117
PDB Compounds: (B:) FabOX117 heavy chainSCOPe Domain Sequences for d4i2xb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4i2xb1 b.1.1.1 (B:1-222) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evklqqsgpelvkpgasvkisckasgysftsyyihwvkqrpgqglewigwvfpgsgntky
nekfkgkatltadtssstaymqlssltsedsavyfcargnydrawfaywgqgtlvtvsaa
kttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdl
ytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdcg
SCOPe Domain Coordinates for d4i2xb1:
Click to download the PDB-style file with coordinates for d4i2xb1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4i2xb1:
- d4i2xb1 is new in SCOPe 2.08-stable
View in 3D
