![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein automated matches [190119] (24 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries) |
![]() | Domain d4hlzg1: 4hlz G:1-213 [408999] Other proteins in same PDB: d4hlza1, d4hlza2, d4hlzb_, d4hlzc1, d4hlzc2, d4hlzd_, d4hlze1, d4hlze2, d4hlzf_, d4hlzg2, d4hlzh1, d4hlzh2, d4hlzj1, d4hlzj2, d4hlzl1, d4hlzl2 automated match to d6shgh_ complexed with edo, nag, so4 |
PDB Entry: 4hlz (more details), 2.9 Å
SCOPe Domain Sequences for d4hlzg1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hlzg1 b.1.1.1 (G:1-213) automated matches {Mouse (Mus musculus) [TaxId: 10090]} evklvesggglvqpggslrlscgtsgftltddymtwvrqppgkalewlgfirdrangytt eysasvkgrftisrdnsqsivylqmntlrvedsatyycarpkgyfpyamdywgqgtsviv sstkttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlq sdlytlsssvtvtsstwpsqsitcnvahpasstkvdkkiepr
Timeline for d4hlzg1: