SCOPe 2.06: Domain d1f98a_: 1f98 A:

Lineage for d1f98a_ (1f98 A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families)
   alpha-beta(2)-alpha(2)-beta(3)

5. Family d.110.3.1: PYP-like [55786] (3 proteins)

6. Protein Photoactive yellow protein, PYP [55787] (1 species)

7. Species Methylophilus methylotrophus, strain w3a1 [TaxId:17] [55788] (68 PDB entries)
   Uniprot P16113

8. Domain d1f98a_: 1f98 A: [40899]
   complexed with hc4; mutant

Details for d1f98a_

PDB Entry: 1f98, 1.15 Å

PDB Description: crystal structure of the photoactive yellow protein mutant t50v

PDB Compounds: (A:) Photoactive yellow protein

SCOPe Domain Sequences for d1f98a_:

Sequence; same for both SEQRES and ATOM records:

>d1f98a_ d.110.3.1 (A:) Photoactive yellow protein, PYP {Methylophilus methylotrophus, strain w3a1 [TaxId: 17]}
mehvafgsedientlakmddgqldglafgaiqldgdgnilqynaaegdivgrdpkqvigk
nffkdvapctdspefygkfkegvasgnlntmfeytfdyqmtptkvkvhmkkalsgdsywv
fvkrv

Timeline for d1f98a_:

• d1f98a_ first appeared (with stable ids) in SCOP 1.55
  
• d1f98a_ appears in SCOPe 2.05
  
• d1f98a_ appears in SCOPe 2.07
  
• d1f98a_ appears in the current release, SCOPe 2.08