Lineage for d1f98a_ (1f98 A:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.110: Profilin-like [55769] (3 superfamilies) Superfamily d.110.3: PYP-like sensor domain [55785] (3 families) 
Family d.110.3.1: Photoactive yellow protein, PYP [55786] (1 protein) Protein Photoactive yellow protein, PYP [55787] (1 species) Species Ectothiorhodospira halophila [TaxId:17] [55788] (8 PDB entries) 
Domain d1f98a_: 1f98 A: [40899]
Details for d1f98a_
PDB Entry: 1f98 (more details), 1.15 Å
PDB Description: crystal structure of the photoactive yellow protein mutant t50v
SCOP Domain Sequences for d1f98a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f98a_ d.110.3.1 (A:) Photoactive yellow protein, PYP {Ectothiorhodospira halophila}
mehvafgsedientlakmddgqldglafgaiqldgdgnilqynaaegdivgrdpkqvigk
nffkdvapctdspefygkfkegvasgnlntmfeytfdyqmtptkvkvhmkkalsgdsywv
fvkrv
SCOP Domain Coordinates for d1f98a_:
Click to download the PDB-style file with coordinates for d1f98a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1f98a_:
- d1f98a_ appears in SCOP 1.57
- d1f98a_ appears in the current release, SCOPe 2.08
View in 3D