Lineage for d1f9ia_ (1f9i A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 509664Fold d.110: Profilin-like [55769] (7 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 509742Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (6 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 509743Family d.110.3.1: PYP-like [55786] (2 proteins)
  6. 509744Protein Photoactive yellow protein, PYP [55787] (1 species)
  7. 509745Species Ectothiorhodospira halophila [TaxId:17] [55788] (27 PDB entries)
  8. 509751Domain d1f9ia_: 1f9i A: [40898]

Details for d1f9ia_

PDB Entry: 1f9i (more details), 1.1 Å

PDB Description: crystal structure of the photoactive yellow protein mutant y42f

SCOP Domain Sequences for d1f9ia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f9ia_ d.110.3.1 (A:) Photoactive yellow protein, PYP {Ectothiorhodospira halophila}
mehvafgsedientlakmddgqldglafgaiqldgdgnilqfnaaegditgrdpkqvigk
nffkdvapctdspefygkfkegvasgnlntmfeytfdyqmtptkvkvhmkkalsgdsywv
fvkrv

SCOP Domain Coordinates for d1f9ia_:

Click to download the PDB-style file with coordinates for d1f9ia_.
(The format of our PDB-style files is described here.)

Timeline for d1f9ia_: